Experimental Methods

CALPAIN2 phosphorylation site summary


Peptides - calp_tio_inhib2.aln

                        1       10        20        30        40        50        60        70        80       
calpain2   DYKDDDDKKEFGTmagiaakLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKelgpyssktrgmrWKRPTEICADPQF
All Expts                                                                                                      
TIO_INHIB2                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     

            90       100       110       120       130       140       150       160       170       180       
calpain2   IIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYagifhfqfwQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKayAK
All Expts                                                                                                      
TIO_INHIB2                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       

           190       200       210       220       230       240       250       260       270       280       
calpain2   INGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNP
All Expts                                                                                                      
TIO_INHIB2                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             

           290       300       310       320       330       340       350       360       370       380       
calpain2   WGEVEWTGRWNDNCPSWNTIDPEERERltrRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKltkMDGNWRRgstaggcrNYPNTFWMNPQY
All Expts                                                             *                     *                  
TIO_INHIB2                                                            *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                
                                                             LEICNLTPDTLTSDTYKK                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       

           390       400       410       420       430       440       450       460       470       480       
calpain2   LIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRarERSDTFINLREVLNRFKLPPGEYILVPS
All Expts                 *                                                            *                       
TIO_INHIB2                *                                                            *                                                                                                                                                                                                                                                                                                                                                                                               
                                                                                   ERSDTFINLR                                                                                                                                                                                                                                                                                                                                                                                          
              LEEEDEDEEDGESGCTFLVGLIQK                                                                                                                                                                                                                                                                                                                                                                                                                                                 

           490       500       510       520       530       540       550       560       570       580       
calpain2   TFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFdiseddiddgvrRLFAQLAGEDAEISAFELQTILRrvlakRQDIKSDGFSIETCKIMVDMLDSD
All Expts                                                                                                      
TIO_INHIB2                                                                                                                                                                                                                                                                                                                                                                                                                 
                                                                                                                                                                                                                                                                                                                                                                                                                           
                                                                                                                                                                                                                                                                                                                                                                                                                           

           590       600       610       620       630       640       650       660       670       680       
calpain2   GSGKLGLKEFYILWTKIQKyqkiyreidvdrSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRletlfkifKQLDPENTGTI
All Expts                                                                                                      
TIO_INHIB2                                                                                                                                                                                                                                                                                                                                                                                                                                                                             
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       

           690       700
calpain2   ELDLISWLcfsvl
All Expts               
TIO_INHIB2                                                                          
                                                                                    
                                                                                    


Legend
*Phosphorylated sites are denoted by an asterisk below the amino acid residue.
[ ] The specific phosphorylated amino acid between the brackets can not be distinguished by the MS/MS spectra.
All Expts A summary of all phosphorylation sites detected on this molecule from all experiments.
C18_INHIB
IMAC_INHIB
TIO_INHIB
Analysis type.
Alternating, aligned peptides represent protein coverage for this experiment
Lower case amino acids have yet to be detected in any enzymatic digest analyzed by mass spectrometry.