| Phosphoproteomics |
Phosphorylation of BPIX
| C18 EGF ETD | Alignment / Methods |
| C18 EGF CAD | Alignment / Methods |
| C18 serum CAD | Alignment / Methods |
| C18 serum starved, 14-Sept-2006 | Alignment / Methods |
| C18 serum only, 14-Sept-2006 | Alignment / Methods |
| C18 PDGF, 14-Sept-2006 | Alignment / Methods |
| C18 EGF, 14-Sept-2006 | Alignment / Methods |
| IMAC serum CAD | Alignment / Methods |
| IMAC serum ETD | Alignment / Methods |
| IMAC EGF CAD | Alignment / Methods |
| IMAC PDGF, 14-Sept-2006 | Alignment / Methods |
| IMAC EGF, 14-Sept-2006 | Alignment / Methods |
| Site | Position | Peptide | ||
|---|---|---|---|---|
| (+) Inhib | ||||
| 71S | 62 - 73 | EIKPSEKPVSPK | ++++ | |
| 71S | 64 - 73 | KPSEKPVSPK | ||
| 79S | 74 - 82 | SGTLKSPPK | ++ | |
| 79S | 74 - 91 | SGTLKSPPKGFDTTAINK | ++++ | |
| 131S | 123 - 160 | LQTSDKLSSANTSYLMGNLEEISSFQQVLVQSLEECTK | +++ | |
| 131S / 135S | 130 - 160 | SSANTSYLMGNLEEISSFQQVLVQSLEECTK | ++++ | |
| 145S / 146S | 141 - 160 | LEEISSFQQVLVQSLEECTK | +++ | |
| 192S / 195S | 188 - 211 | ANHPSAVSVLTEHSEDLGEFMETK | +++ | |
| 340S | 339 - 347 | MSGFIYQGK | +++ | |
| 340S | 339 - 357 | MSGFIYQGKLPTTGMTITK | +++ | |
| 427S-428S | 401 - 429 | VTSVSNPTIKPHSVPSHTLPSHPLTP[SS]K | ++++ | |
| 498S | 479 - 500 | PAPPLRPSAALCYKEDLSKSPK | ||
| 516S | 509 - 523 | RKPERKPSDEEFAVR | ++++ | |
| 516S | 509 - 524 | RKPERKPSDEEFAVRK | +++ | |
| 516S | 514 - 523 | KPSDEEFAVR | +++ | |
| 516S | 514 - 524 | KPSDEEFAVRK | +++ | |
| 516S | 516 - 523 | SDEEFAVR | ||
| 542Y | 538 - 547 | VIEAYCTSAK | ||
| 560S | 558 - 571 | KESAPQVLLPEEEK | ||
| 560S | 558 - 578 | KESAPQVLLPEEEKIIVEETK | ||
| 589S / 593T | 582 - 605 | QTVIEEKSLVDTVYALKDEVQELR | ++++ |
*Peptides detected only by
enrichment with
immobilized metal-affinity chromatography (IMAC).
# Peptides which do not require enrichment by IMAC for detection.
